PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01007.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 475aa    MW: 53587.4 Da    PI: 7.8874
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01007.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-17230276148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT +Ed ll ++v ++G+++W+ Ia++++ gR +kqc++rw+++l
  Rsa1.0_01007.1_g00004.1 230 KGQWTSDEDRLLMQLVGLHGTKRWSQIAKMLQ-GRVGKQCRERWHNHL 276
                              799*****************************.*************97 PP

2Myb_DNA-binding52.51.1e-16283324245
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              + W+++Ed +l++a+k+ G++ W+ Iar+++ gRt++ +k++w+
  Rsa1.0_01007.1_g00004.1 283 DGWSEQEDRILIEAHKEIGNR-WAEIARKLP-GRTENTIKNHWN 324
                              56*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.077225280IPR017930Myb domain
SuperFamilySSF466892.06E-30227323IPR009057Homeodomain-like
SMARTSM007173.7E-15229278IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-27231284IPR009057Homeodomain-like
PfamPF139211.7E-17233290No hitNo description
CDDcd001674.77E-14233276No hitNo description
PROSITE profilePS5129419.999281331IPR017930Myb domain
SMARTSM007178.9E-16281329IPR001005SANT/Myb domain
CDDcd001671.03E-12285327No hitNo description
Gene3DG3DSA:1.10.10.601.8E-20285329IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1904095Biological Processnegative regulation of endosperm development
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MHYPYLASVI FDDNVTLKDV HPSLTDDASF VQNVHHKPFH ANLDRSHVPS IINSDLCHQN  60
PILKISNATS DHIPNLNISP RHYDMQPHTF DSVSKYIFNG ITSSPCTEAF EAYLRGISSD  120
QDLFNMACNT SHPVESNDLP NISHVPIDNT MWDNNRNQGI IFGTESIFNL AMVDSYGAPK  180
PICILGANDD TTMNQHQNNQ IMIKADQIKK NKRFQMRRGS KLTRKTSIIK GQWTSDEDRL  240
LMQLVGLHGT KRWSQIAKML QGRVGKQCRE RWHNHLRPDI KKDGWSEQED RILIEAHKEI  300
GNRWAEIARK LPGRTENTIK NHWNATKRKQ HSRKFKGKDE VSLALGSDTL QNYIRSVTYN  360
DDTFMTTTSK SNTNNGRKNM RGKGKAVIVS ASGYDKIDDD NECTYIVDGV MNLNLDKSAT  420
CVSKSTSASG STVGSGSGVT EVDEPMADSW MVMHGCDEVM MKEIALLEMI AHGRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-452283302104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00385DAPTransfer from AT3G27785Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009129392.10.0PREDICTED: uncharacterized protein LOC103854215
RefseqXP_013720880.10.0PREDICTED: uncharacterized protein LOC106424668
TrEMBLM4EW440.0M4EW44_BRARP; Uncharacterized protein
STRINGBra033027.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60522643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.10.0myb domain protein 118